DMRC Recruitment 2015 – Apply Online for 1509 Maintainer, Operator & Other Posts: Read more: DMRC Recruitment 2015 - Apply Online for 1509 Maintainer, Operator & Other Posts

DMRC Recruitment 2015 – Apply Online for 1509 Maintainer, Operator & Other Posts: Delhi Metro Rail Corporation (DMRC) Limited has published a notification for the recruitment of 1509 Assistant Manager/ Finance, Station Controller/ Train Operator, Customer Relations Assistant, Junior Engineer/ Electrical, Junior Engineer/ Electronics, Junior Engineer/ Mechanical, Junior Engineer/ Civil, Office & Account Assistant, Stenographer and Maintainer vacancies on direct recruitment basis. Eligible candidates may apply online from 24-10-2015 at 10:00 hrs to 25-11-2015 by 23:59 hrs. Other details like age, educational qualification, selection process, how to apply are given below…

DMRC Vacancy Details: 
Total No. of Posts: 1509 
Name of the Post: 
I. Section-A-Executive: 02 Posts
1. Assistant Manager/ Finance: 02 Posts
II. Section-B-Non Executive: 1507 Posts
1. Station Controller/ Train Operator (SC/ TO): 395 Posts
2. Customer Relations Assistant (CRA): 176 Posts
3. Junior Engineer/ Electrical: 107 Posts
4. Junior Engineer/ Electronics: 99 Posts
5. Junior Engineer/ Mechanical: 39 Posts
6. Junior Engineer/ Civil: 22 Posts
7. Office Assistant: 09 Posts
8. Account Assistant: 11 Posts
9. Stenographer: 15 Posts
10. Maintainer: 634 Posts

Age Limit: Candidates age should be between 18 to 28 years for S.No- I & II 1 to II 9 posts and 18 to 25 years for II 10 post as on 01-07-2015. Age relaxation is applicable upto 5 years for SC/ ST, 3 years for OBC, 10 years for PwD and 5 years for Jammu & Kashmir candidates as per rules.

Educational Qualification: Candidates should possess CA/ ICWA with a minimum of 50% marks for S.No- I, three years Engineering Diploma in Electrical/ Electronic or equivalent or BSC Hons in (Physics/ Chemistry/ Maths) or B.Sc (Physics/ Chemistry/ Maths) from a Government recognized University/ Institute for S.No- II1, three/ four years Graduation course in any discipline from a Government Recognized University & computer literacy for S.No- II2, three years Engineering Diploma in Electrical/ equivalent trade for S.No- II 3. For more information refer notification.

Selection Process: Candidates will be selected based on written test, group discussion, psycho test, medical examination, skill test & interview.

Application Fee: Candidates have to pay Rs. 400/- (Rs. 150/- for SC/ ST/ PwD candidates) (inclusive of bank charges plus service tax) through system generated bank challan will be triplicate (1st copy- Bank copy, 2nd copy- candidates copy, 3rd copy-DMRC copy) can be deposited account no.33700092265 in any branch of State bank of India.

How to Apply: Eligible candidates may apply online through website www.delhimetrorail.com from 24-10-2015 at 10:00 hrs to 25-11-2015 by 23:59 hrs.

Instructions to Apply Online: 1. Before applying online candidates should have valid email id and Contact No. 2. Candidates are neatly scanned the photograph, Signature & relevant documents at the time of apply online. 3. Log on to the website www.delhimetrorail.com. 4. Click on “Careers”. 5. Select the Desired Post. 6. Click on “Apply Online”. 7. Again Click on “Apply Online”. 8. Fill all the mandatory details. 9. Take print out of application form for future use.

Important Dates:

Starting Date for Submission of Online Application	24-10-2015 at 10:00 hrs
Last Date for Submission of Online Application	25-11-2015 by 23:59 hrs
Application Fee to be Paid Between	From 26-10-2015 to 27-11-2015
Bank Challan will be generated upto, through DMRC Website	25-11-2015 by 23:59 hrs

For more details like age, educational qualification, selection process, application fee, how to apply & other information click on the link given below…

Notification	More Details
Recruitment Advt	Get Details
How to Apply Online	Get Details
Guidelines	Get Details
FAQs	Get Details
Caste Certificates for SC and ST	Get Details
Certificate for Other Backward Classes	Get Details
Apply Online	Click Here

How to apply 

1. Candidates are required to apply online through website www.delhimetrorail.com only. No other means/mode of application will be accepted.
2. Candidates are required to have a valid personal e-mail ID. It should be kept active during the currency of this recruitment process. In case a candidate does not have a valid personal e-mail ID, he/she should create his/her new e-mail ID before applying online. Under no circumstances, he/she should share/mention e-mail ID to/of any other person.
3. Candidates are first required to go to the DMRC’s website www.delhimetrorail.com and click on the link “Career”.
 4. Thereafter, he/she may open the recruitment notification titled“DMRC / OM / HR / I / 2015”.
5. He/she should thoroughly go through the vacancy notification first to let him/her know the eligibility, age criteria etc.
 6. Candidates are required to click the link “Apply Online” and fill up the Online Application Properly.
7. Once you submit the Application a Reference/Registration Number will be generated on screen along with a button to download preprinted Challan form with Bank Reference Number (the reference number will be unique).
 8. The Online Application will be submitted till 27/11/2015 (upto 23.59 hrs) and accordingly Bank Challan will also be generated only upto 25/11/2015 (upto 23.59 hrs) from the date of issue of advertisement.
9. The system generated Bank challan will be in triplicate (1st copy – Bank Copy, 2 nd copy – Candidate’s Copy and 3 rd copy – DMRC’s Copy). Candidates are required to take a print out of this system generated Bank Challan and deposit the requisite Written Examination Fee (for fee details see para “Payment of application fee”) in any branch of State Bank of India (SBI) after a minimum of 24 hrs of generation of the Bank Challan. Only, State Bank of India (SBI) has been authorized by DMRC to collect the application fee, in a specially opened DMRC Account No. 33700092265 i) For payment of fees, candidate has to approach the nearest SBI branch with the system generated bank challan only, with a unique ‘Bank Reference Number” in triplicate (1st copy – Bank Copy, 2nd copy – Candidate’s Copy and 3rd copy – DMRC’s Copy) downloaded from DMRC website www.delhimetrorail.com. ii) The system generated challan printed from the DMRC website should only be used for depositing the fee for proper crediting amount in the allocatedaccount. iii) On receipt of the money, the bank will issue a unique Journal Number and a Branch code of the bank collecting the money. Candidates are required to collect the “Candidate’s Copy” and “DMRC Copy” from the bank. They are also required to ensure themselves that these bank challans contain i) SBI Journal number ii) Branch Name iii) Branch code No. iv) Date of deposit v)Amount. iv) DMRC will not be responsible in case the candidate deposits the fee in a wrong account. There will not be any other mode of payment of application fee. v) Application fee is to be paid between 26/10/2015 to 27/11/2015 only. vi) Demand Drafts, Cheques, Money Orders, Postal Orders, Pay Orders, Banker’s Cheques, postal stamps, etc., will not be accepted, towards applicationfee.
10. Candidates are advised to visit DMRC website, only after a minimum of two working days of depositing the fee in the bank by re-visiting the career link i.e. “DMRC / OM / HR / I / 2015” on DMRC’s website www.delhimetrorail.com and by going to sub link titled “Candidate Login (Re-print of Challan or Registration Slip)” and check the status of Application/ Download Registration Slip.
11. In order to avoid last minute rush, the candidates are advised to apply early enough. DMRC will not be responsible for network problems or any other problem of this nature in submission of online application during last days due to heavy rushetc.
12. Select the post applied and fills in the requisite details in the online application format. All the fields in the online application format should be filled up carefully. There will be a pre-view of the applications filled in by the candidate before submitting the application, so that it can be edited. After submission of the application, no modification will bepermitted. 13. Candidates will have to upload scanned copy of passport colour photo, signature scan copy, OBC/SC/ST /PWD certificates (Whichever is applicable). The size and type of these scanned copies should be as per guidelines given on Website under Section “Guidelines for scanning Photo/Signature/certificates”. 14. Once you check your application status and if Payment status is confirmed then you will be able to download Registration slip only

Grand Slam Tournaments On Underwater Tennis Court

Consequent to gloating about a tennis court high unverifiable built on the 1,000-foot-tall Burj al Arab lodging, Dubai has enchanted a designer to give things a shot for a submerged tennis court. Sparkle engineer Krysztof Kotala has proposed to amass a submerged tennis unpredictable discovered toward the ocean in the Persian Gulf, between the Burj al Arab and the Palm Jumeirah islands.

Delineated with a monstrous twisted housetop, the undersea complex will spread out to hold seven courts. The recreations stadium will similarly twist around as an aquarium with a roof coral reef, which will put on display a wealth of sea life for spectators and furthermore players. Considered to make a fantasy of a trademark atoll, once made, the glass disguised court will add to Dubai’s amazing record-breaking shoreline. In any case, creators and specialists have voiced reasons for alarm about building the submerged nook as it stances various challenges which, at this time, seem, by all accounts, to be hard to succeed.

A part of the snags fuse making a single bit of glass adequately colossal to cover the structure and adequately strong to withstand the heaviness of the water. It is being evaluated that the clear rooftop would oblige a determined sheet of glass measuring no under 108 extensive to suit the court and spectators.

However Kotala is smooth with his eminent organizes and is not open to blow it out of the water, “This will be something one of a kind. It should be some spot where there is the custom of tennis. Dubai is perfect for this idea.”

मंद बुद्धि से महानता तक : तीन वैज्ञानिकों का प्रेरणादायी जीवन

मंद बुद्धि से महानता तक : तीन वैज्ञानिकों का प्रेरणादायी जीवन

अपनी  intelligence से  दुनिया  को  अनूठे तोहफे  देने वाले  कुछ  महान  लोग  अजीब  आदतों  के  शिकार  थे  और  उन्हें दुनिया  भी  फिसड्डी  ही  मानती  थी . शुरू में  लोगों  ने  उन्हें  ताने  दिए  और उन्हें  सनकी ,पागल  और  नाकारा  समझा . लेकिन  जब  इन लोगो  ने  अपनी काबिलियत  का  परिचय  दिया  तो  दुनिया  में  परिवर्तन  आ  गया . आइये हम  ऐसे ही कुछ महान वैज्ञानिकों के जीवन के कुछ रोचक व प्रेरणादायक तथ्य जानते हैं :

Sir Isaac Newton / सर आइज़क न्यूटन  (25 December 1642 – 20 March 1727)

आइज़क न्यूटन

दुनिया को  गुरुत्वाकर्षण  का  सिद्धांत  देने वाले  Sir Issac Newton शुरुआती  दिनों  में  ठीक  प्रकार से  बोल  भी  नहीं  पाते  थे . वे स्वभाव से काफी गुस्सैल  थे  और  लोगों  से  कम  ही  वास्ता रखते  थे . उनके  इसी  व्यव्हार  के  कारण  उनके  मित्र  भी  न के  बराबर थे . newton अपने  विचार  भी  सही  ढंग  से  व्यक्त  नहीं  कर  पाते   थे ,वह अपने  उपलब्धियों  या  खोज  को  बताने  में  संकोच  करते   कि  कहीं  वह  हंसी के  पात्र  न  बन  जाएं . शुरुआती  दिनों  में  Newton कई  प्रकार  के प्रयोग  करते  रहते  थे .Newton के  व्यव्हार  के कारण  उन्हें  सनकी  और  पागल समझा  गया  पर  लोगों की परवाह किये बगैर वे अपने शोध में लगे रहे और अंततः एक महान  वैज्ञानिक  बनकर उभरे और एक  genius के रूप में विख्यात हुए।

Thomas Alva Edison / थॉमस अल्वा एडिसन   (February 11, 1847 – October 18, 1931)

आज आपके कमरे  में  जो  bulb रौशनी  करता  है ,उसका आविष्कार  Thomas Alva Edison ने किया  था . विद्युत्  बल्ब   के  जनक  के  नाम  से  मशहूर  Edison को  शुरू  में  फिस्सड्डी और  मंद  बुद्धि  बालक  समझा  जाता  था ,लेकिन निरंतर परिश्रम के बल पर एक  दिन उन्होंने  अपने अविष्कार से सारी   दुनिया  प्रकाशमय  कर  दी .Edison ने  सिर्फ बल्ब  ही  नहीं  ,बल्कि सैकड़ों अन्य अविष्कार भी  दुनिया  को  दिए। वे  अधिकांश  समय  अपनी  प्रयोगशाला  में  बिताते  थे . अविष्कारों  को लेकर  उनके  जूनून  को  देखकर  लोग  उन्हें  सनकी  और  पागल  तक  समझने  लगे थे। बचपन  में  भी  वे  अजीब  हरकतो  के  लिए  जेन  जाते थे  . कहा  जाता  है कि  एक  बार  चिड़ियों  को  कीड़े  खाते  देख  उन्होंने  यह  सोचा  कि  उड़ने  के लिए  कीड़े  खाना  शायद  जरुरी  है . बस  ,कुछ  कीड़े  इकट्ठे  कर उसका  घोल  बनाकर  उसे अपने  दोस्त  को  पिलाने  कि  कोशिश की  . वे देखना  चाहते  थे  कि  उनका  दोस्त  इसके  बाद  उड़ने  लगेगा  या  नहीं . जाहिर है  कि  उन्हें  सबने   खूब  डांटा   और उनपर  पाबंदिया  भी  लगाई  गई . पर  उनकी  इसी जिज्ञासु प्रवित्ति ने  दुनिया  बदल  दी . (थॉमस ए. एडीसन के अनमोल विचार)

Albert Einstein /अल्बर्ट आइंस्टीन  (14 March 1879 – 18 April 1955)          

महान  वैज्ञानिकों में  Albert Einstein का  नाम  सबसे  पहले  रखा  जाता  है . 1879 में जन्मे  Albert Einstein तीन  साल  तक  डिस्लेक्सिया  से  पीड़ित  थे  और   बोल  भी  नहीं  पाते   थे . तेरह  साल  कि  उम्र तक  वह  अपने  जूतो   के  फीते  बांधना  भी  नहीं  सीख  पाये  थे . Einstein शुरू  में  न  तो  गुणा -भाग  कर  पाते  थे  और  न ही  शब्दों  को  सही तरह  से  लिख  पाते   थे . उनके शिक्षक  हमेशा  उनके  बारे  में  नकारात्मक टिपण्णी  करते  थे .Einstein general relativity का  सिद्धांत  प्रतिपादित कर   इतिहास  में  अमर  हो  गए . उनके  इस  सिद्धांत से  विज्ञान  के  क्षेत्र  में  क्रांति आ गयी।  अपनी  इस  उपलब्धि  के  लिए  वह आधुनिक  भौतिकी  के  जनक  कहलाये .Einstein को  विज्ञान   में  अद्भुत योगदान ,खासकर  law of photoelectric effect कि  खोज  के  लिए 1921 में Nobel पुरस्कार  से  सम्मानित  किया  गया .  (अल्बर्ट आइंस्टीन के अनमोल विचार)

Friends, इन माहन वैज्ञानिकों का जीवन दर्शाता है कि कमजोर शुरुआत और दुनिया भर के विरोध के बावजूद धुन का पक्का व्यक्ति कुछ भी कर गुजर सकता है। हमें भी इनसे सीख लेते हुए  सामने आने वाली मुश्किलों  से घबराये बिना निरंतर  अपने  लक्ष्य की और  बढ़ते रहना चाहिए और एक दिन अपने सपनो को साकार करना चाहिए।

गर्लफ्रेंड बनते ही लड़कियों में आते हैं ये 10 बदलाव

नींद उड़ जाना

आप जब रिलेशनशिप में होती हैं, तो आपके बिहेव और मूड में चेंजेस होना आम बात है। इस दौर से कई लड़कियां गुजरती हैं, इस वक्त उनमें अपनेआप ही कुछ बदलाव आने लगते हैं। आइए जानते हैं गर्लफ्रेंड बनने के बाद लड़कियों में क्या चेंजेस होते हैं-

नींद उड़ जाना
किसी ने सच ही कहा है कि जब प्यार होता है तो नींद उड़ जाती है। ऎसा ही लड़कियों के साथ भी होता है। वे अक्सर देर रात तक जागकर अपने ब्वॉयफ्रेंड से चैट या कॉल पर बात करती रहती है। कॉल काटने के बाद भी वे पूरे वक्त अपने ब्वॉयफ्रेंड के बारे में ही सोचती रहती है। इस तरह उनकी रातें केवल करवटें बदलते हुए ही निकल जाती है

आयने के सामने मुस्कुराना

आयने के सामने मुस्कुराना: ब्वॉयफ्रेंड बनाने के बाद आप अक्सर खुद को आयने के सामने देखकर शर्माने लगती हैं। शीशे के सामने खुद को निहारते रहना और फिर खुद ही शर्मा जाना प्यार में होने का साइन है। रिलेशनशिप में होने पर लड़कियां अक्सर खुद में ही खोई रहती है और अपने ब्वॉयफ्रेंड के साथ बिताए पलों को याद करके खुश होती है।

गर्लफ्रेंड बनते ही लड़कियों में आते हैं ये 10 बदलाव

मोबाइल पर बातें करते रहना

मोबाइल पर बातें करते रहना: जब आपको प्यार होता है तो आप अपना ज्यादातर वक्त अपने ब्वॉयफ्रेंड से चैट या कॉल करने में बिताती है। पूरे वक्त आपका ध्यान आपके मोबाइल में ही लगा रहता है। क ई बार तो आप रात को बार-बार जागकर अपने मोबाइल को टटोलती रहती है। मोबाइल और रिलेशनशिप का बड़ा गहरा रिश्ता है।

रोमांटिक सॉन्ग्स और मूवीज

रोमांटिक सॉन्ग्स और मूवीज: प्यार में पड़ने के बाद आपको हर लव स्टोरी अपनी जैसी ही लगती है। आप हर वक्त रोमांटिक सॉन्ग्स सुनती है। रॉक म्यूजिक की जगह आपकी म्यूजिक लाइब्रेरी रोमांटिक सॉन्ग्स से भर जाती है, मोबाइल की रिंगटोन भी लव सॉन्ग बन जाती है। रिलेशनशिप में आने के बाद रोमांटिक मूवीज भी आपकी फेवरेट लिस्ट में शामिल हो जाती है।

ड्रेसिंग सेंस में बदलाव

ड्रेसिंग सेंस में बदलाव: जब प्यार होता है तो आप चाहती हैं कि आपके ब्वॉयफ्रेंड के सामने आप हमेशा प्रजेंटेबल रहें। इसके लिए आप अपने ड्रेसिंग सेंस, बिहेव और लुक में बदलाव करती है। आप अच्छी दिखने में कोई कसर नहीं छोड़ना चाहती हैं। अक्सर कहा जाता है कि प्यार में इंसान निखर जाता है, ये बात लड़कियों पर बिल्कुल फिट बैठती है।

दोस्तों से दूर हो जाना

दोस्तों से दूर हो जाना: दोस्त हमारी जिंदगी का बहुत अहम हिस्सा होते हैं, लेकिन एक बार प्यार में पड़ जाने पर उन्हीं दोस्तों से आप दूर होने लगती है। अक्सर ऎसा होता है कि रिलेशनशिप में जाने के बाद लड़कियां अपने दोस्तों की बजाए अपने ब्वॉयफ्रेंड के साथ घूमना पसंद करती हैं। ऎसे में ब्वॉयफ्रेंड का साथ मिलने पर दोस्त कोई पीछे छूटने लगते हैं।

हर बात में सलाह देना

हर बात में सलाह देना: रिलेशनशिप में आने से पहले जहां आप बहुत बेफ्रिक और केयरलेस होती है, वहीं गर्लफ्रेंड बनते ही आप में एकदम से बदलाव आने लगते हैं। आपको हर वक्त अपने ब्वॉयफ्रेंड की चिंता सताती रहती है, जिसके चलते आप उन्हें टाइम पर घर जाने, खाना खाने जैसी कई सलाहें दे डालती हैं। कुछ वक्त तक ये किसी को भी अच्छा लगेगा, लेकिन जरूरत से ज्यादा केयरिंग नैचर आपकी लिए बुरा साबित हो सकता है।

जासूसी करना

जासूसी करना: कई बार आप अपने ब्वॉयफ्रेंड को लेकर इतना ज्यादा पजेसिव हो जाती हैं कि उनकी जासूसी करने लगती हैं। ब्वॉयफ्रेंड के मोबाइल से लेकर उनके सोशल अकाउंट सब पर आपकी नजर रहती है। आप चाहे कितना भी नर्म रहने की कोशिश करें, लेकिन रिलेशनशिप में थोड़ी पजेसिवनेस आ ही जाती है।

जेलस होना

जेलस होना: रिलेशनशिप में आने पर अपने ब्वॉयफ्रेंड को लेकर इनसिक्योर होना आम बात है। पहले जहां आपको किसी से कुछ फर्क नहीं पड़ता था, वहीं अब अगर आपके ब्वॉयफ्रेंड से कोई लड़की ज्यादा बात करने लगे तो आपको बुरा लग जाता है।

अपनी इंपोर्टेस भूल जाना

अपनी इंपोर्टेस भूल जाना: प्यार में दोनों लोगों की बराबर इंपोर्टेस होती है, लेकिन लड़कियां अक्सर खुद को भूलकर केवल अपने ब्वॉयफ्रेंड के बारे में ही सोचने लगती है। ऎसे में उनकी पसंद-नापसंद ही आपकी पसंद बन जाती है। अपने से ज्यादा आप अपने ब्वॉयफ्रेंड के मूड के हिसाब से काम करती हैं।

- 

DIGI LOCKER

• 
                 English                 हिन्दी               

 
 

Online Applications

No photocopy, no couriers, no scanning… applying online is so easy thanks to DigiLocker

PreviousNext

How It Works?

Login Using Aadhaar

View Issued Documents

Upload Documents

eSign Documents

Share Documents

DigiLocker National Statistics

987401 users

969860 documents

How can I get a DigiLocker account?

To sign up for DigiLocker, you need your Aadhaar number (issued by UIDAI). There are two ways to sign up:

1. Mobile OTP: Use this method if your Aadhaar number is linked to your mobile number.

2. Biometric:If you have a biometric device attached to your computer, you can sign up by scanning your fingerprint.

DigiLocker in the News

• 5 things you should know about Digital Locker (Business Standard)
• India's Digital Locker Initiative Draws Crowds (NDTV Gadgets)
• Live paperless; keep sensitive data, documents safe in DigiLocker (Economic Times)
• Prime Minister to Launch Digital Locker Facility Next Week (NDTV Gadgets)
• Centre’s ‘Digital Locker’ to empower citizens (Indian Express)

Don't have a DigiLocker account? 

•  About |
•  Statistics |
•  FAQs |
•  Resource Center |
•  Contact us

•    
•    
•    
•   

•    
•    

National eGovernance Division 
© Department of Electronics & Information Technology (DeitY) 
Ministry of Communications & IT, Government of India
Copyright @2015

Feasting on mutton!

Mutton Nihari

Ingredients

• 1 kg Mutton (It should be cut into big pieces)
• 1 ½ tbsp red chilly powder
• 1 tbsp all spice powder
• 2 tbsp ginger garlic paste
• ½ tbsp turmeric powder
• 1 tbsp cumin powder
• 1 tbsp black pepper powder
• 1 ½ tbsp saunf powder (fennel seeds)
• ½ tbsp green cardamom powder
• One big piece of cinnamon
• ½ tbsp clove powder
• 1 medium sized onion finely chopped
• Few green chillies
• 2 inch piece of ginger
• 2 cups ghee
• ½ cup wheat flour
• 1 lemon
• Salt to taste
• Water

Method

• Cut and clean the mutton pieces and drain them very well.
• Put some ghee in a pressure cooker. Once the ghee is hot, add the mutton pieces and fry well till they turn nice and golden.
• Now add ginger garlic paste and fry it further.
• Add salt and stir. Mix all the powdered masala and sauté it well.
• Pour 4 to 5 glasses of water and close the lid of the cooker. Leave it for around 35 minutes for the meat to become tender.
• Take a separate pan now and put some oil. Fry the onions till they turn golden brown. Remove them once done on a kitchen tissue and crush it to fine powder.
• When the meat becomes totally tender, add the crushed onions and let it simmer for some time.
• Make a paste of the wheat flour and some water. Add this paste to the curry and stir it well. Make sure that the gravy thickens.
• Decorate it with ginger and lemon wedges, and serve it with roti or bread depending on the choice.

Photograph: Maria Alexandra/ Creative Commons

Golden Fried Mutton Chops

Ingredients

• 1 kg Mutton chops
• 1 tbsp ginger garlic paste
• ½ tbsp red chilly powder
• 1 tsp turmeric powder
• 1 tbsp coriander powder
• 1 tsp garam masala powder
• 1 tsp black pepper powder
• 2 to 3 eggs
• 1 cup bread crumbs
• Salt to taste
• Oil for deep frying

 Method

• Wash and drain mutton chops very well.
• Add salt, ginger garlic paste, chilly powder, coriander powder, turmeric powder, garam masala powder, black pepper powder and keep it aside for an hour, preferably in the fridge so that the mutton chunks get marinated.
• After an hour, place the mutton chunks in a pressure cooker and cook in low flame, for it to become tender.
• Open the lid of the cooker and check if the chops are tender. If it’s done, then cook it on high flame until all the water evaporates.
• Now keep it aside and let it cool.
• Take two bowls. In one bowl, beat the eggs and in the other spread the breadcrumbs for they will be used for coating.
• Pour some oil in the frying pan. Take out each chopped piece of mutton with a fork, dip it in the beaten egg, and roll it in bread crumbs, and deep fry the pieces in hot oil. Fry it till it turns golden brown.
• Garnish the mutton pieces with lemon and fresh coriander leaves.
• Serve hot.

CMC-Welcome to the New Online Registration Process for NEW PATIENTS ONLY..

 

CHRISTIAN MEDICAL COLLEGE - VELLORE

ONLINE APPOINTMENTS

---

Welcome to the New Online Registration Process for NEW PATIENTS ONLY..

Already Registered User?

Welcome!

Please Enter the Registered Web TransID and Web Invoice Number to make an Appointment/Payment.

 *

          

 *

New User?

IMPORTANT: Make sure that you have all the information required on this form when you begin. Once you have completed and submitted the information, you will not be able to change any of the details. Make sure that you do the Online Payment within half an hour. If the time limit exceeds, the Invoice Number will be allotted to some other Patients. The information that you fill in here will be submitted to CMC Vellore. General instructions to book New appointments online: On clicking “Click here to register Online” icon, you are directed to page where personal & residence details of the patient has to be filled in. On submitting the filled in form, the transaction number, Bill number & Invoice number will be generated, which has to be noted down for future reference. Then you will be requested to select the appointment category (General or Private). If a Private doctor is chosen then, select the doctor you would prefer to consult along with the appointment date and payment mode. You will be directed to HDFC payment site. There you will have to enter the required payment information. In case of failure, the slot will be available for the next 30 minutes for you to retry. On successful completion of the payment, the system will allow you to take a print out of the appointment. A message to the specified mobile number and a mail to the specified mail ID will be sent. In case of payment failure, where the money gets deducted but the appointment site closes or no information is displayed, then you can login using the transaction number and random sequence number to get a print out. If the slot is allotted to another patient, the system will check and refund back the money automatically after 20 minutes. In case you find after a confirmed payment the appointment slot has not been allotted, the system will automatically allot the slot and sends the message and the email. The patient can login to take the required printout. Refunds for appointments booked online will not be made.

Terms & Conditions      Privacy Policy

FIND SCHOOL REPORT CARD

       

• Home
• Locate School
• Basic Search
• Advance Search
• School Directory
• Missing Schools
• Raw Data
• Mobile Apps
• Gender Atlas

		School Directory
Academic Year	Select Year  2014-15  2013-14  2012-13  2011-12	State	ANDAMAN & NICOBAR ISLANDSANDHRA PRADESHARUNACHAL PRADESHASSAMBIHARCHANDIGARHCHHATTISGARHDADRA & NAGAR HAVELIDAMAN & DIUDELHIGOAGUJARATHARYANAHIMACHAL PRADESHJAMMU AND KASHMIRJHARKHANDKARNATAKAKERALALAKSHADWEEPMADHYA PRADESHMAHARASHTRAMANIPURMEGHALAYAMIZORAMNAGALANDORISSAPONDICHERRYPUNJABRAJASTHANSIKKIMTAMIL NADUTRIPURAUTTAR PRADESHUTTARANCHALWEST BENGAL	District
Block		Cluster		Village

 

Search Result Contains :

Academic Year:

State:

District:

Block:

Cluster:

Village: